<?xml version="1.0" encoding="UTF-8"?>
<rss xmlns:content="http://purl.org/rss/1.0/modules/content/" xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:taxo="http://purl.org/rss/1.0/modules/taxonomy/" version="2.0">
  <channel>
    <title>topic asa 5516-x dropping DHCP packets even after ACL allow in Network Security</title>
    <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711217#M13551</link>
    <description>&lt;P&gt;Hi All&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Please help me find out why this FTD ASA 5516-X is dropping DHCP packets even after I've allowed it on the ACL:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Phase: 5&lt;BR /&gt;Type: ACCESS-LIST&lt;BR /&gt;Subtype:&lt;BR /&gt;Result: DROP&lt;BR /&gt;Config:&lt;BR /&gt;Implicit Rule&lt;BR /&gt;Additional Information:&lt;BR /&gt; Forward Flow based lookup yields rule:&lt;BR /&gt; in id=0x2aaada976990, priority=0, domain=permit, deny=true&lt;BR /&gt; hits=725, user_data=0xa, cs_id=0x0, use_real_addr, flags=0x1000, protocol=0&lt;BR /&gt; src ip/id=0.0.0.0, mask=0.0.0.0, port=0, tag=any&lt;BR /&gt; dst ip/id=0.0.0.0, mask=0.0.0.0, port=0, tag=any, dscp=0x0&lt;BR /&gt; input_ifc=Inside-CWG_Wifi_SBP, output_ifc=any&lt;/P&gt;
&lt;P&gt;Result:&lt;BR /&gt;input-interface: Inside-CWG_Wifi_SBP&lt;BR /&gt;input-status: up&lt;BR /&gt;input-line-status: up&lt;BR /&gt;output-interface: NP Identity Ifc&lt;BR /&gt;Action: drop&lt;BR /&gt;Drop-reason: (acl-drop) Flow is denied by configured rule&lt;/P&gt;
&lt;P&gt;&amp;gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;393: 16:08:19.513050 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 300 Drop-reason: (acl-drop) Flow is denied by configured rule&lt;BR /&gt; 394: 16:08:20.695459 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 300 Drop-reason: (acl-drop) Flow is denied by configured rule&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;192.168.55.250 is the DHCP server on this ASA. As the packets are dropped there are no DHCP packets registered:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;gt; show dhcpd statistics&lt;BR /&gt;DHCP UDP Unreachable Errors: 0&lt;BR /&gt;DHCP Other UDP Errors: 0&lt;/P&gt;
&lt;P&gt;Address pools 3&lt;BR /&gt;Automatic bindings 0&lt;BR /&gt;Expired bindings 0&lt;BR /&gt;Malformed messages 0&lt;/P&gt;
&lt;P&gt;Message Received&lt;BR /&gt;BOOTREQUEST 0&lt;BR /&gt;DHCPDISCOVER 0&lt;BR /&gt;DHCPREQUEST 0&lt;BR /&gt;DHCPDECLINE 0&lt;BR /&gt;DHCPRELEASE 0&lt;BR /&gt;DHCPINFORM 0&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;ACL has been allowed for this:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;access-list CSM_FW_ACL_ line 27 remark rule-id 268436481: L7 RULE: DHCP&lt;BR /&gt;access-list CSM_FW_ACL_ line 28 advanced permit udp ifc Inside any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0xe4664fff&lt;BR /&gt;access-list CSM_FW_ACL_ line 29 advanced permit udp ifc Inside any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0xe74f89e5&lt;BR /&gt;access-list CSM_FW_ACL_ line 30 advanced permit udp ifc Inside any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0x51f2199b&lt;BR /&gt;access-list CSM_FW_ACL_ line 31 advanced permit udp ifc Inside any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x38d1b7c1&lt;BR /&gt;access-list CSM_FW_ACL_ line 32 advanced permit udp ifc Inside-TP-Desktop any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0x61419d5e&lt;BR /&gt;access-list CSM_FW_ACL_ line 33 advanced permit udp ifc Inside-TP-Desktop any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0xbbd2c408&lt;BR /&gt;access-list CSM_FW_ACL_ line 34 advanced permit udp ifc Inside-TP-Desktop any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0xa610180f&lt;BR /&gt;access-list CSM_FW_ACL_ line 35 advanced permit udp ifc Inside-TP-Desktop any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x5f42843b&lt;BR /&gt;access-list CSM_FW_ACL_ line 36 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0x5af3a636&lt;BR /&gt;access-list CSM_FW_ACL_ line 37 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0xe6b86f1b&lt;BR /&gt;access-list CSM_FW_ACL_ line 38 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0xd7403e07&lt;BR /&gt;access-list CSM_FW_ACL_ line 39 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x677af08d&lt;BR /&gt;access-list CSM_FW_ACL_ line 40 advanced permit udp ifc AP_Management any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0x1ed16681&lt;BR /&gt;access-list CSM_FW_ACL_ line 41 advanced permit udp ifc AP_Management any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0x5826aa69&lt;BR /&gt;access-list CSM_FW_ACL_ line 42 advanced permit udp ifc AP_Management any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0xd6d350d0&lt;BR /&gt;access-list CSM_FW_ACL_ line 43 advanced permit udp ifc AP_Management any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x93785eef&lt;/P&gt;</description>
    <pubDate>Fri, 21 Feb 2020 16:16:07 GMT</pubDate>
    <dc:creator>IP Team</dc:creator>
    <dc:date>2020-02-21T16:16:07Z</dc:date>
    <item>
      <title>asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711217#M13551</link>
      <description>&lt;P&gt;Hi All&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Please help me find out why this FTD ASA 5516-X is dropping DHCP packets even after I've allowed it on the ACL:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Phase: 5&lt;BR /&gt;Type: ACCESS-LIST&lt;BR /&gt;Subtype:&lt;BR /&gt;Result: DROP&lt;BR /&gt;Config:&lt;BR /&gt;Implicit Rule&lt;BR /&gt;Additional Information:&lt;BR /&gt; Forward Flow based lookup yields rule:&lt;BR /&gt; in id=0x2aaada976990, priority=0, domain=permit, deny=true&lt;BR /&gt; hits=725, user_data=0xa, cs_id=0x0, use_real_addr, flags=0x1000, protocol=0&lt;BR /&gt; src ip/id=0.0.0.0, mask=0.0.0.0, port=0, tag=any&lt;BR /&gt; dst ip/id=0.0.0.0, mask=0.0.0.0, port=0, tag=any, dscp=0x0&lt;BR /&gt; input_ifc=Inside-CWG_Wifi_SBP, output_ifc=any&lt;/P&gt;
&lt;P&gt;Result:&lt;BR /&gt;input-interface: Inside-CWG_Wifi_SBP&lt;BR /&gt;input-status: up&lt;BR /&gt;input-line-status: up&lt;BR /&gt;output-interface: NP Identity Ifc&lt;BR /&gt;Action: drop&lt;BR /&gt;Drop-reason: (acl-drop) Flow is denied by configured rule&lt;/P&gt;
&lt;P&gt;&amp;gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;393: 16:08:19.513050 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 300 Drop-reason: (acl-drop) Flow is denied by configured rule&lt;BR /&gt; 394: 16:08:20.695459 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 300 Drop-reason: (acl-drop) Flow is denied by configured rule&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;192.168.55.250 is the DHCP server on this ASA. As the packets are dropped there are no DHCP packets registered:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;gt; show dhcpd statistics&lt;BR /&gt;DHCP UDP Unreachable Errors: 0&lt;BR /&gt;DHCP Other UDP Errors: 0&lt;/P&gt;
&lt;P&gt;Address pools 3&lt;BR /&gt;Automatic bindings 0&lt;BR /&gt;Expired bindings 0&lt;BR /&gt;Malformed messages 0&lt;/P&gt;
&lt;P&gt;Message Received&lt;BR /&gt;BOOTREQUEST 0&lt;BR /&gt;DHCPDISCOVER 0&lt;BR /&gt;DHCPREQUEST 0&lt;BR /&gt;DHCPDECLINE 0&lt;BR /&gt;DHCPRELEASE 0&lt;BR /&gt;DHCPINFORM 0&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;ACL has been allowed for this:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;access-list CSM_FW_ACL_ line 27 remark rule-id 268436481: L7 RULE: DHCP&lt;BR /&gt;access-list CSM_FW_ACL_ line 28 advanced permit udp ifc Inside any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0xe4664fff&lt;BR /&gt;access-list CSM_FW_ACL_ line 29 advanced permit udp ifc Inside any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0xe74f89e5&lt;BR /&gt;access-list CSM_FW_ACL_ line 30 advanced permit udp ifc Inside any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0x51f2199b&lt;BR /&gt;access-list CSM_FW_ACL_ line 31 advanced permit udp ifc Inside any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x38d1b7c1&lt;BR /&gt;access-list CSM_FW_ACL_ line 32 advanced permit udp ifc Inside-TP-Desktop any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0x61419d5e&lt;BR /&gt;access-list CSM_FW_ACL_ line 33 advanced permit udp ifc Inside-TP-Desktop any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0xbbd2c408&lt;BR /&gt;access-list CSM_FW_ACL_ line 34 advanced permit udp ifc Inside-TP-Desktop any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0xa610180f&lt;BR /&gt;access-list CSM_FW_ACL_ line 35 advanced permit udp ifc Inside-TP-Desktop any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x5f42843b&lt;BR /&gt;access-list CSM_FW_ACL_ line 36 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0x5af3a636&lt;BR /&gt;access-list CSM_FW_ACL_ line 37 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0xe6b86f1b&lt;BR /&gt;access-list CSM_FW_ACL_ line 38 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0xd7403e07&lt;BR /&gt;access-list CSM_FW_ACL_ line 39 advanced permit udp ifc Inside-CWG_Wifi_SBP any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x677af08d&lt;BR /&gt;access-list CSM_FW_ACL_ line 40 advanced permit udp ifc AP_Management any eq bootps any eq bootps rule-id 268436481 (hitcnt=0) 0x1ed16681&lt;BR /&gt;access-list CSM_FW_ACL_ line 41 advanced permit udp ifc AP_Management any eq bootps any eq bootpc rule-id 268436481 (hitcnt=0) 0x5826aa69&lt;BR /&gt;access-list CSM_FW_ACL_ line 42 advanced permit udp ifc AP_Management any eq bootpc any eq bootps rule-id 268436481 (hitcnt=0) 0xd6d350d0&lt;BR /&gt;access-list CSM_FW_ACL_ line 43 advanced permit udp ifc AP_Management any eq bootpc any eq bootpc rule-id 268436481 (hitcnt=0) 0x93785eef&lt;/P&gt;</description>
      <pubDate>Fri, 21 Feb 2020 16:16:07 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711217#M13551</guid>
      <dc:creator>IP Team</dc:creator>
      <dc:date>2020-02-21T16:16:07Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711300#M13552</link>
      <description>&lt;P&gt;Try running the following debug in the FTD CLI to identify which rule it is hitting:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;gt; system support firewall-engine-debug&lt;/P&gt;
&lt;P&gt;Please specify an IP protocol:&amp;nbsp; &amp;lt;press enter&amp;gt;&lt;BR /&gt;Please specify a client IP address: &amp;lt;IP of client PC&amp;gt;&lt;BR /&gt;Please specify a client port: &amp;lt;press enter&amp;gt;&lt;BR /&gt;Please specify a server IP address: &amp;lt;IP of DHCP server&amp;gt;&lt;BR /&gt;Please specify a server port: &amp;lt;press enter&amp;gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;</description>
      <pubDate>Fri, 21 Sep 2018 18:23:00 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711300#M13552</guid>
      <dc:creator>Marius Gunnerud</dc:creator>
      <dc:date>2018-09-21T18:23:00Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711469#M13553</link>
      <description>&lt;P&gt;In addition to what&amp;nbsp;&lt;a href="https://community.cisco.com/t5/user/viewprofilepage/user-id/319690"&gt;@Marius Gunnerud&lt;/a&gt;&amp;nbsp;correctly suggested, note that ACLs are for traffic THROUGH the firewall - to TO the firewall.&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;I'd also check that the firewall is listening for DHCP on udp/67 (show asp table sockets) and that it is receiving the DHCP discover packets (via packet capture).&lt;/P&gt;</description>
      <pubDate>Sat, 22 Sep 2018 04:36:21 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711469#M13553</guid>
      <dc:creator>Marvin Rhoads</dc:creator>
      <dc:date>2018-09-22T04:36:21Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711500#M13554</link>
      <description>Thanks for the suggestion,&lt;BR /&gt;&lt;BR /&gt;Unfortunately I’m not on site to generate DHCP packets but the packet tracer output says it’s denied by an implicit rule:&lt;BR /&gt;&lt;BR /&gt;Phase: 5&lt;BR /&gt;Type: ACCESS-LIST&lt;BR /&gt;Subtype:&lt;BR /&gt;Result: DROP&lt;BR /&gt;Config:&lt;BR /&gt;Implicit Rule   &amp;lt;&amp;lt;&amp;lt;&amp;lt;&amp;lt;&amp;lt;&amp;lt;&lt;BR /&gt;&lt;BR /&gt;Additionally packet tracer shows:&lt;BR /&gt;Additional Information:&lt;BR /&gt;Forward Flow based lookup yields rule:&lt;BR /&gt;in  id=0x2aaada976990, priority=0, domain=permit, deny=true&lt;BR /&gt;&lt;BR /&gt;is that id the ACL id?</description>
      <pubDate>Sat, 22 Sep 2018 07:44:34 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711500#M13554</guid>
      <dc:creator>IP Team</dc:creator>
      <dc:date>2018-09-22T07:44:34Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711501#M13555</link>
      <description>&lt;P&gt;Hi Marvin,&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Thanks -&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;gt; show asp table socket stats&lt;/P&gt;
&lt;P&gt;TCP Statistics:&lt;BR /&gt; Rcvd:&lt;BR /&gt; total 0&lt;BR /&gt; checksum errors 0&lt;BR /&gt; no port 0&lt;BR /&gt; Sent:&lt;BR /&gt; total 0&lt;/P&gt;
&lt;P&gt;&lt;BR /&gt;UDP Statistics:&lt;BR /&gt; Rcvd:&lt;BR /&gt; total 0&lt;BR /&gt; checksum errors 0&lt;BR /&gt; Sent:&lt;BR /&gt; total 0&lt;BR /&gt; copied 0&lt;BR /&gt; Dropped:&lt;BR /&gt; Rcv queue full 0&lt;/P&gt;
&lt;P&gt;&lt;BR /&gt;NP SSL System Stats:&lt;BR /&gt; Handshake Started: 0&lt;BR /&gt; Handshake Complete: 0&lt;BR /&gt; SSL Open: 0&lt;BR /&gt; SSL Close: 0&lt;BR /&gt; SSL Server: 0&lt;BR /&gt; SSL Server Verify: 0&lt;BR /&gt; SSL Client: 0&lt;/P&gt;
&lt;P&gt;&amp;gt;&lt;BR /&gt;&amp;gt;&lt;BR /&gt;&amp;gt;&lt;BR /&gt;&amp;gt; show asp table socket&lt;/P&gt;
&lt;P&gt;&lt;BR /&gt;Protocol Socket State Local Address Foreign Address&lt;BR /&gt;&amp;gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Packet capture:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;476: 07:42:16.831179 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 0&lt;BR /&gt; 477: 07:42:44.529422 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 0&lt;BR /&gt; 478: 07:44:10.373744 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 0&lt;BR /&gt; 479: 07:44:13.255067 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 0&lt;BR /&gt; 480: 07:44:15.266480 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 0&lt;BR /&gt; 481: 07:44:17.405984 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: udp 0&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;192.168.55.250 is the DHCP server interface&lt;/P&gt;</description>
      <pubDate>Sat, 22 Sep 2018 07:50:58 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711501#M13555</guid>
      <dc:creator>IP Team</dc:creator>
      <dc:date>2018-09-22T07:50:58Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711503#M13556</link>
      <description>&lt;P&gt;looking at detail packet capture for one of the DHCP packets received on the expected interface:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;307: 16:08:40.828738 00fc.baa8.92d1 28ac.9e3b.c954 0x8100 Length: 346&lt;BR /&gt; 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: [udp sum ok] udp 300 (ttl 255, id 51328)&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&lt;SPAN&gt;separately in drop packet capture:&lt;/SPAN&gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;398: 16:08:40.798832 00fc.baa8.92d1 28ac.9e3b.c954 0x8100 Length: 346&lt;BR /&gt; 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: [udp sum ok] udp 300 (ttl 255, id 51072) Drop-reason: (acl-drop) Flow is denied by configured rule&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;399: 16:08:40.828799 00fc.baa8.92d1 28ac.9e3b.c954 0x8100 Length: 346&lt;BR /&gt; 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: [udp sum ok] udp 300 (ttl 255, id 51328) Drop-reason: (acl-drop) Flow is denied by configured rule&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;400: 16:08:42.456839 00fc.baa8.92d1 28ac.9e3b.c954 0x8100 Length: 346&lt;BR /&gt; 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: [udp sum ok] udp 300 (ttl 255, id 51584) Drop-reason: (acl-drop) Flow is denied by configured rule&lt;BR /&gt;&lt;BR /&gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&lt;SPAN&gt;&amp;nbsp;&lt;/SPAN&gt;&lt;/P&gt;</description>
      <pubDate>Sat, 22 Sep 2018 08:00:07 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711503#M13556</guid>
      <dc:creator>IP Team</dc:creator>
      <dc:date>2018-09-22T08:00:07Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711636#M13557</link>
      <description>&lt;P&gt;Hello,&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;If I understood it correctly, its a dhcp relay scenario. If yes, then packet-tracer won't be a good idea since the dhcp discover (broadcast packet) will be intercepted by ASA and send to DHCP server as a unicast changing the headers. Can you please provide the dhcp relay configuration that you have done.&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Or is it being already handled by another dhcp relay agent and sent as a unicast packet to ASA and getting dropped. If this is a case, please confirm the setup you have.&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;You can run some debugs and see what is happening to packets.&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;HTH&lt;/P&gt;
&lt;P&gt;AJ&lt;/P&gt;</description>
      <pubDate>Sun, 23 Sep 2018 07:42:35 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711636#M13557</guid>
      <dc:creator>Ajay Saini</dc:creator>
      <dc:date>2018-09-23T07:42:35Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711685#M13558</link>
      <description>&lt;P&gt;Hi Ajay,&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Good point.&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;The DHCP relay config is on a Nexus 9K, with one physical interface trunking towards the ASA 5516-X. The ASA has 3 subinterfaces each with a DHCP server configured.&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;On the 9K SVI (default gateway to clients):&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;interface Vlan554&lt;/P&gt;
&lt;P&gt;ip address 192.168.55.254/23&lt;BR /&gt; ip dhcp relay address 192.168.55.250&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Physical interface is configured as a trunk and allowing the above VLAN:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;On ASA:&lt;/P&gt;
&lt;P&gt;GigabitEthernet1/2.554 Inside-CWG_Wifi_SBP 192.168.55.250 255.255.254.0 CONFIG&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;!&lt;BR /&gt;dhcpd address 192.168.54.10-192.168.55.9 Inside-CWG_Wifi_SBP&lt;BR /&gt;dhcpd enable Inside-CWG_Wifi_SBP&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;Earlier on the N9K interface VLAN 554 i tried this:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;interface Vlan554&lt;/P&gt;
&lt;P&gt;ip address dhcp&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;And this got an IP! So DHCP is working on the ASA but DHCP relay is not working on the N9K&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;So when the N9K interface i set to receive an address via DHCP:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;gt; show dhcpd binding&lt;/P&gt;
&lt;P&gt;IP address Client Identifier Lease expiration Type&lt;/P&gt;
&lt;P&gt;192.168.54.11 0046.444f.3232.3039. 3592 seconds Automatic&lt;BR /&gt; 3234.5638.566c.616e.&lt;BR /&gt; 3535.34&lt;BR /&gt;&amp;gt; show dhcpd statistics&lt;BR /&gt;DHCP UDP Unreachable Errors: 0&lt;BR /&gt;DHCP Other UDP Errors: 0&lt;/P&gt;
&lt;P&gt;Address pools 3&lt;BR /&gt;Automatic bindings 1&lt;BR /&gt;Expired bindings 0&lt;BR /&gt;Malformed messages 0&lt;/P&gt;
&lt;P&gt;Message Received&lt;BR /&gt;BOOTREQUEST 0&lt;BR /&gt;DHCPDISCOVER 2&lt;BR /&gt;DHCPREQUEST 2&lt;BR /&gt;DHCPDECLINE 0&lt;BR /&gt;DHCPRELEASE 1&lt;BR /&gt;DHCPINFORM 0&lt;/P&gt;
&lt;P&gt;Message Sent&lt;BR /&gt;BOOTREPLY 0&lt;BR /&gt;DHCPOFFER 2&lt;BR /&gt;DHCPACK 2&lt;BR /&gt;DHCPNAK 0&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;597: 21:08:37.082347 802.1Q vlan#554 P0 0.0.0.0.68 &amp;gt; 255.255.255.255.67: udp 314&lt;BR /&gt; 598: 21:08:37.082576 802.1Q vlan#554 P0 arp who-has 192.168.54.11 tell 192.168.55.250&lt;BR /&gt; 599: 21:08:37.180135 802.1Q vlan#554 P0 192.168.55.250.67 &amp;gt; 255.255.255.255.68: udp 290&lt;BR /&gt; 600: 21:08:38.230029 802.1Q vlan#554 P0 arp who-has 192.168.54.11 tell 192.168.55.250&lt;BR /&gt; 601: 21:08:39.230044 802.1Q vlan#554 P0 arp who-has 192.168.54.11 tell 192.168.55.250&lt;BR /&gt; 602: 21:08:43.085780 802.1Q vlan#554 P0 0.0.0.0.68 &amp;gt; 255.255.255.255.67: udp 326&lt;BR /&gt; 603: 21:08:43.085963 802.1Q vlan#554 P0 192.168.55.250.67 &amp;gt; 255.255.255.255.68: udp 290&lt;BR /&gt; 604: 21:08:43.230044 802.1Q vlan#554 P0 arp who-has 192.168.54.11 tell 192.168.55.250&lt;BR /&gt; 605: 21:08:43.471395 802.1Q vlan#554 P6 arp who-has 192.168.54.11 (ff:ff:ff:ff:ff:ff) tell 192.168.54.11&lt;BR /&gt; 606: 21:08:43.551652 802.1Q vlan#554 P6 arp who-has 192.168.55.250 (ff:ff:ff:ff:ff:ff) tell 192.168.54.11&lt;BR /&gt; 607: 21:08:43.551775 802.1Q vlan#554 P6 arp reply 192.168.55.250 is-at 28:ac:9e:3b:c9:54&lt;BR /&gt; 608: 21:08:48.230060 802.1Q vlan#554 P0 arp who-has 192.168.54.11 tell 192.168.55.250&lt;BR /&gt; 609: 21:08:48.230578 802.1Q vlan#554 P6 arp reply 192.168.54.11 is-at 0:fc:ba:a8:92:d1&lt;BR /&gt; 610: 21:08:48.230838 802.1Q vlan#554 P0 192.168.55.250 &amp;gt; 192.168.54.11: icmp: echo request&lt;BR /&gt; 611: 21:08:48.231112 802.1Q vlan#554 P0 192.168.54.11 &amp;gt; 192.168.55.250: icmp: echo reply&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;The captures in earlier post show when the dhcp relay message gets dropped:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;DIV class="lia-page"&gt;&lt;CENTER&gt;
&lt;DIV class="MinimumWidthContainer"&gt;
&lt;DIV class="min-width-wrapper"&gt;
&lt;DIV class="min-width"&gt;
&lt;DIV class="lia-content"&gt;
&lt;DIV class="lia-quilt lia-quilt-forum-topic-page lia-quilt-layout-two-column-16-8 lia-top-quilt"&gt;
&lt;DIV class="lia-quilt-row lia-quilt-row-main"&gt;
&lt;DIV class="lia-quilt-column lia-quilt-column-18 lia-quilt-column-left lia-quilt-column-main-content"&gt;
&lt;DIV class="lia-quilt-column-alley lia-quilt-column-alley-left"&gt;
&lt;DIV class="lia-component-reply-list"&gt;
&lt;DIV class="linear-message-list message-list"&gt;
&lt;DIV id="lineardisplaymessageviewwrapper_3" class="lia-linear-display-message-view"&gt;
&lt;DIV&gt;
&lt;DIV id="messageview_3" class="lia-panel-message message-uid-3711503" data-lia-message-uid="3711503"&gt;
&lt;DIV class="custom-reply custom-reply-indent custom-reply-indent-4"&gt;
&lt;DIV id="messageView2_1_3" class="lia-message-view-wrapper lia-js-data-messageUid-3711503 lia-component-forums-widget-message-view-two" data-lia-message-uid="3711503"&gt;
&lt;DIV class="MessageView lia-message-view-forum-message lia-message-view-display lia-row-standard-unread lia-thread-reply"&gt;
&lt;DIV class="lia-quilt lia-quilt-forum-message lia-quilt-layout-one-column-message"&gt;
&lt;DIV class="lia-quilt-row lia-quilt-row-main"&gt;
&lt;DIV class="lia-quilt-column lia-quilt-column-24 lia-quilt-column-single lia-quilt-column-main"&gt;
&lt;DIV class="lia-quilt-column-alley lia-quilt-column-alley-single"&gt;
&lt;DIV id="messageBodySimpleDisplay_3" class="lia-message-body lia-component-body-signature-highlight-escalation"&gt;
&lt;DIV class="lia-message-body-content"&gt;
&lt;P&gt;399: 16:08:40.828799 00fc.baa8.92d1 28ac.9e3b.c954 0x8100 Length: 346&lt;BR /&gt; 802.1Q vlan#554 P0 192.168.55.254.67 &amp;gt; 192.168.55.250.67: [udp sum ok] udp 300 (ttl 255, id 51328) Drop-reason: (acl-drop) Flow is denied by configured rule&lt;/P&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/DIV&gt;
&lt;/CENTER&gt;&lt;/DIV&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;</description>
      <pubDate>Sun, 23 Sep 2018 12:33:00 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711685#M13558</guid>
      <dc:creator>IP Team</dc:creator>
      <dc:date>2018-09-23T12:33:00Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711840#M13559</link>
      <description>&lt;P&gt;Unfortunately, this design is not supported because of a limitation on ASA. The client must be in same l2 broadcast domain as the ASA interface where the clients are connected. From the ASA guide:&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&lt;A href="https://www.cisco.com/c/en/us/td/docs/security/asa/asa97/configuration/general/asa-97-general-config/basic-dhcp-ddns.html" target="_blank"&gt;https://www.cisco.com/c/en/us/td/docs/security/asa/asa97/configuration/general/asa-97-general-config/basic-dhcp-ddns.html&lt;/A&gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&lt;FONT size="2"&gt;&lt;EM&gt;You cannot configure a DHCP client or DHCP relay service on an interface on which the server is enabled. Additionally, DHCP clients must be directly connected to the interface on which the server is enabled.&lt;/EM&gt;&lt;/FONT&gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&lt;FONT size="3"&gt;The way it can work is if the ASA acts as L3 gateway and Nexus 9k acts as l2 .&lt;/FONT&gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&lt;FONT size="3"&gt;HTH&lt;BR /&gt;AJ&lt;/FONT&gt;&lt;/P&gt;
&lt;P&gt;&lt;FONT size="3"&gt;&lt;EM&gt;&lt;SPAN&gt;&amp;nbsp;&lt;/SPAN&gt;&lt;/EM&gt;&lt;/FONT&gt;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;
&lt;P&gt;&amp;nbsp;&lt;/P&gt;</description>
      <pubDate>Mon, 24 Sep 2018 06:25:48 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711840#M13559</guid>
      <dc:creator>Ajay Saini</dc:creator>
      <dc:date>2018-09-24T06:25:48Z</dc:date>
    </item>
    <item>
      <title>Re: asa 5516-x dropping DHCP packets even after ACL allow</title>
      <link>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711843#M13632</link>
      <description>Hi AJ&lt;BR /&gt;&lt;BR /&gt;That’s it, I took off the relay config on the N9K and it worked!&lt;BR /&gt;&lt;BR /&gt;Thanks very much!!&lt;BR /&gt;&lt;BR /&gt;Regards&lt;BR /&gt;Shams</description>
      <pubDate>Mon, 24 Sep 2018 06:41:45 GMT</pubDate>
      <guid>https://community.cisco.com/t5/network-security/asa-5516-x-dropping-dhcp-packets-even-after-acl-allow/m-p/3711843#M13632</guid>
      <dc:creator>IP Team</dc:creator>
      <dc:date>2018-09-24T06:41:45Z</dc:date>
    </item>
  </channel>
</rss>

